PDB entry 6iw4

View 6iw4 on RCSB PDB site
Description: Crystal structure of YFV-17D sE in prefusion state
Class: viral protein
Keywords: Yellow fever virus, Envelope protein, Flavivirus, VIRAL PROTEIN
Deposited on 2018-12-04, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Yellow fever virus (strain 17D vaccine) [TaxId:11090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw4a1, d6iw4a2
  • Chain 'B':
    Compound: Envelope protein E
    Species: Yellow fever virus (strain 17D vaccine) [TaxId:11090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iw4b1, d6iw4b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iw4A (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
    ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykic
    tdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgrgdsrltyqwhkegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iw4A (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
    ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtlyklhgghvscrvklsaltlkgtsykictdkm
    ffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpiastnddevl
    ievnppfgdsyiivgrgdsrltyqwhke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iw4B (B:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
    ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgtsykic
    tdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpiastnd
    devlievnppfgdsyiivgrgdsrltyqwhkegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iw4B (B:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
    ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
    ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdtlyklhgghvscrvklsaltlkgtsykictdkm
    ffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpiastnddevl
    ievnppfgdsyiivgrgdsrltyqwhke