PDB entry 6iw3

View 6iw3 on RCSB PDB site
Description: High resolution structure of Dvl2-DIX Y27W/C80S mutant
Class: signaling protein
Keywords: Wnt signalling, SIGNALING PROTEIN
Deposited on 2018-12-04, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segment polarity protein dishevelled homolog DVL-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (0-End)
      • engineered mutation (15)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6iw3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iw3A (A:)
    getkviyhldeeetpwlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkeei
    sddnarlpsfngrvvswlvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iw3A (A:)
    getkviyhldeeetpwlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkeei
    sddnarlpsfngrvvswlvss