PDB entry 6ivz

View 6ivz on RCSB PDB site
Description: Crystal structure of 5A ScFv complexed with YFV-China sE in postfusion state
Class: viral protein/immune system
Keywords: Yellow fever virus, Neutralizing monoclonal antibody, Envelope protein, Flavivirus, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-12-04, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Yellow fever virus [TaxId:11089]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ivza1, d6ivza2
  • Chain 'H':
    Compound: Heavy chain of monoclonal antibody 5A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IVZ (Start-120)
    Domains in SCOPe 2.07: d6ivzh_
  • Chain 'L':
    Compound: Light chain of monoclonal antibody 5A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IVZ
    Domains in SCOPe 2.07: d6ivzl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ivzA (A:)
    ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
    ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
    caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
    ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
    tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmc
    tdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastnd
    devlievnppfgdsyiivgtgdsrltyqwhkegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivzA (A:)
    hcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvcy
    savlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakftc
    aksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatle
    cqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaat
    irvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgtsykmct
    dkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpiastndd
    evlievnppfgdsyiivgtgdsrltyqwhke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ivzH (H:)
    mevqlvesgprlvkpsetlsltctvsggstynhhwswirqppgrglewigyisysgksny
    npslksrvtislepsttqfslklnsltaadtavyycareyrddtnyyyysldvwgpgtmv
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivzH (H:)
    evqlvesgprlvkpsetlsltctvsggstynhhwswirqppgrglewigyisysgksnyn
    pslksrvtislepsttqfslklnsltaadtavyycareyrddtnyyyysldvwgpgtmvt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ivzL (L:)
    vssggggsggggsggggsggggsqivmtqspstlsasvgdrvtitcrasqsigswlawyq
    qkpgkapklliykasslesgvpsrfsgsgsgteftltisslqpedfatyycqqynnysyt
    fgpgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivzL (L:)
    ivmtqspstlsasvgdrvtitcrasqsigswlawyqqkpgkapklliykasslesgvpsr
    fsgsgsgteftltisslqpedfatyycqqynnysytfgpgtkleik