PDB entry 6ivx

View 6ivx on RCSB PDB site
Description: Discovery of the Second Generation ROR gamma Inhibitors Composed of an Azole Scaffold.
Class: nuclear protein/inhibitor
Keywords: Ternary Complex, Nuclear Receptor, NUCLEAR PROTEIN, NUCLEAR PROTEIN-INHIBITOR complex, IMMUNE SYSTEM
Deposited on 2018-12-04, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6ivxa_
  • Chain 'B':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6ivxc_
  • Chain 'D':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6ivxe_
  • Chain 'F':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d6ivxg_
  • Chain 'H':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AYO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ivxA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivxA (A:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ivxC (C:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivxC (C:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ivxE (E:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivxE (E:)
    slteiehlvqsvcksyretcqrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ivxG (G:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ivxG (G:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpi
    

  • Chain 'H':
    No sequence available.