PDB entry 6iuv

View 6iuv on RCSB PDB site
Description: Crystal structure of influenza A virus H5 hemagglutinin globular head in complex with the Fab of antibody 3C11
Class: immune system
Keywords: influenza virus, HPAI, H5N1, neutralizing antibody, epitope, major vulnerable site, vaccine development, IMMUNE SYSTEM
Deposited on 2018-11-30, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Hong Kong/482/97(H5N1)) [TaxId:155218]
    Gene: H5, HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Hong Kong/482/97(H5N1)) [TaxId:155218]
    Gene: H5, HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3C11 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IUV
  • Chain 'D':
    Compound: 3C11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IUV (0-End)
    Domains in SCOPe 2.07: d6iuvd1, d6iuvd2
  • Chain 'H':
    Compound: 3C11 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IUV (Start-228)
  • Chain 'L':
    Compound: 3C11 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IUV (0-End)
    Domains in SCOPe 2.07: d6iuvl1, d6iuvl2
  • Heterogens: NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6iuvD (D:)
    eivmtqspltlpvtpgapasiscrssqsllhsdgynyldwylqkpgqspqlliylgshra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpdfgqgtrleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iuvD (D:)
    eivmtqspltlpvtpgapasiscrssqsllhsdgynyldwylqkpgqspqlliylgshra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpdfgqgtrleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6iuvL (L:)
    eivmtqspltlpvtpgapasiscrssqsllhsdgynyldwylqkpgqspqlliylgshra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpdfgqgtrleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iuvL (L:)
    eivmtqspltlpvtpgapasiscrssqsllhsdgynyldwylqkpgqspqlliylgshra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpdfgqgtrleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr