PDB entry 6itj

View 6itj on RCSB PDB site
Description: Crystal structure of FGFR1 kinase domain in complex with compound 3
Class: transferase/inhibitor
Keywords: protein kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2018-11-23, released 2019-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-307)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6itja_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (30)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6itjb_
  • Heterogens: AXU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6itjA (A:)
    agvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlk
    sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
    ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
    kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
    gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
    valtsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6itjA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyyk
    kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
    ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6itjB (B:)
    agvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlk
    sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
    ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
    kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
    gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
    valtsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6itjB (B:)
    gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlks
    datekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrp
    pgleysypeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    laidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpvee
    lfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalt