PDB entry 6isd

View 6isd on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana HPPD complexed with sulcotrione
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: 4-Hydroxyphenylpyruvate dioxygenase, Slow binding inhibitors, drug design, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2018-11-16, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6isda1, d6isda2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6isdb1, d6isdb2
  • Heterogens: 5BQ, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6isdA (A:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6isdA (A:)
    skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
    ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsykflpgfervedfpldygirrldha
    vgnvpelgpaltyvagftgfhqfaefsglnsavlasndemvllpinepvhgrksqiqtyl
    ehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddq
    ikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfs
    elfksieey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6isdB (B:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6isdB (B:)
    skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
    ltsgdlrflftapyspsptttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsykflpgfervefpldygirrldhav
    gnvpelgpaltyvagftgfhqfaefesglnsavlasndemvllpinepvhgrksqiqtyl
    ehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddq
    ikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfs
    elfksieeyek