PDB entry 6ipy

View 6ipy on RCSB PDB site
Description: His-tagged Fyn SH3 domain R96I mutant
Class: protein binding
Keywords: kinase, SH3 domain, hexa-histidine tag, crystal stabilized by histidine tag, PROTEIN BINDING
Deposited on 2018-11-05, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Fyn
    Species: Homo sapiens [TaxId:9606]
    Gene: FYN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (10-72)
      • engineered mutation (24)
      • expression tag (73-76)
    Domains in SCOPe 2.08: d6ipya1, d6ipya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ipyA (A:)
nfvlegdihmtgvtlfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetg
yipsnyvapvdsilehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6ipyA (A:)
tgvtlfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
dsilehh