PDB entry 6io1

View 6io1 on RCSB PDB site
Description: Crystal structure of a novel thermostable (S)-enantioselective omega-transaminase from Thermomicrobium roseum
Class: transferase
Keywords: enantioselectivity, omega-transaminase, substrate recognition Thermomicrobium roseum, transamination, TRANSFERASE
Deposited on 2018-10-29, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, class III
    Species: Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) [TaxId:309801]
    Gene: trd_1080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6io1a_
  • Chain 'B':
    Compound: Aminotransferase, class III
    Species: Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) [TaxId:309801]
    Gene: trd_1080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6io1b_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6io1A (A:)
    mqvetwnaaelvakdiahhlhpltnlyqlrregplvlvrgegvwvwdaegkryldgfagl
    wnvnighgrrelaeaareqmervafvptffglaspptielaarlaelfpgpldhfqftsg
    gaesnetaikiaryywwlkgqpervkilsrrmayhgiamgalsatgvpaywegfgprppg
    fihltapykyrfgegltdeefvarlvqeleetieregsetiaafigepvqgaggvvvppd
    gywpaiaavlrkygillildevitgfgrtgtlfgmqqygvqpdivtfakgitsgyvplgg
    vgvsdeiaetlasadrvfmhgftysghpvacavalrnldillaerlwenaaasgayllqe
    lkrleerpyvgevrgkglmllvevvrdkaskekfppefklgpkleaatrrrgiivrctpd
    givmappltisraecdvliegvaaalsdvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6io1A (A:)
    vetwnaaelvakdiahhlhpltnlyqlrregplvlvrgegvwvwdaegkryldgfaglwn
    vnighgrrelaeaareqmervafvptffglaspptielaarlaelfpgpldhfqftsgga
    esnetaikiaryywwlkgqpervkilsrrmayhgiaalsatgvpaywegfgprppgfihl
    tapykyrfgegltdeefvarlvqeleetieregsetiaafigepvqgaggvvvppdgywp
    aiaavlrkygillildevitgfgrtgtlfgmqqygvqpdivtfakgitsgyvplggvgvs
    deiaetlasadrvfmhgftysghpvacavalrnldillaerlwenaaasgayllqelkrl
    eerpyvgevrgkglmllvevvrdkaskekfppefklgpkleaatrrrgiivrctpdgivm
    appltisraecdvliegvaaalsdvld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6io1B (B:)
    mqvetwnaaelvakdiahhlhpltnlyqlrregplvlvrgegvwvwdaegkryldgfagl
    wnvnighgrrelaeaareqmervafvptffglaspptielaarlaelfpgpldhfqftsg
    gaesnetaikiaryywwlkgqpervkilsrrmayhgiamgalsatgvpaywegfgprppg
    fihltapykyrfgegltdeefvarlvqeleetieregsetiaafigepvqgaggvvvppd
    gywpaiaavlrkygillildevitgfgrtgtlfgmqqygvqpdivtfakgitsgyvplgg
    vgvsdeiaetlasadrvfmhgftysghpvacavalrnldillaerlwenaaasgayllqe
    lkrleerpyvgevrgkglmllvevvrdkaskekfppefklgpkleaatrrrgiivrctpd
    givmappltisraecdvliegvaaalsdvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6io1B (B:)
    etwnaaelvakdiahhlhpltnlyqlrregplvlvrgegvwvwdaegkryldgfaglwnv
    nighgrrelaeaareqmervafvptffglaspptielaarlaelfpgpldhfqftsggae
    snetaikiaryywwlkgqpervkilsrrmayhgiamgalsatgvpaywegfgprppgfih
    ltapykyrfgegltdeefvarlvqeleetieregsetiaafigepvqgaggvvvppdgyw
    paiaavlrkygillildevitgfgrtgtlfgmqqygvqpdivtfakgitsgyvplggvgv
    sdeiaetlasadrvfmhgftysghpvacavalrnldillaerlwenaaasgayllqelkr
    leerpyvgevrgkglmllvevvrdkaskekfppefklgpkleaatrrrgiivrctpdgiv
    mappltisraecdvliegvaaalsdvld