PDB entry 6int

View 6int on RCSB PDB site
Description: xylose isomerase from Paenibacillus sp. R4
Class: isomerase
Keywords: Paenibacillus species, cold-active protein, ISOMERASE
Deposited on 2018-10-26, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6inta_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6intb_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6intc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6intd_
  • Chain 'E':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6inte_
  • Chain 'F':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6intf_
  • Chain 'G':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6intg_
  • Chain 'H':
    Compound: xylose isomerase
    Species: Paenibacillus sp. R4 [TaxId:1079050]
    Database cross-references and differences (RAF-indexed):
    • PDB 6INT (Start-437)
    Domains in SCOPe 2.07: d6inth_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6intA (A:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intA (A:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6intB (B:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intB (B:)
    fdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacfe
    llnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftnp
    rfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleldn
    larflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnle
    anhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilqn
    eggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieery
    asftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6intC (C:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intC (C:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6intD (D:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intD (D:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6intE (E:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intE (E:)
    fdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacfe
    llnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftnp
    rfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleldn
    larflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnle
    anhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilqn
    eggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieery
    asftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6intF (F:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intF (F:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6intG (G:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intG (G:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6intH (H:)
    mgyfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaywhsftgngsdpfg
    agtalrgwnelsgmelakarveacfellnildvdyfcfhdrdiapegdtlqetnrnldei
    valikqhmhssgkkllwntanmftnprfvhgaattsnadvfayaaaqvkkaldhgkelga
    enyvfwggregyesllntdlgleldnlarflqlavdyakeigfdaqfliepkpkepskhq
    ydfdaattlqflqkydlakhfklnleanhatlaghtfehelrvaringalgsidanqgdl
    llgwdtdefptdlyastlamyeilqneggigrggvnfdakvrrtsfepidvvyahingmd
    afarglqvaakliedrafdnvieeryasftkgigadivsgkanfhtleayalqnnpitnk
    sgrvellrsilnqyiinv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6intH (H:)
    yfdhvgtvkfegksstnplafkfynpdeiilgktmrehlrfgvaylsgmelakarveacf
    ellnildvdyfcfhdrdiapegdtlqetnrnldeivalikqhmhssgkkllwntanmftn
    prfvhgaattsnadvfayaaaqvkkaldhgkelgaenyvfwggregyesllntdlgleld
    nlarflqlavdyakeigfdaqfliepkpkepskhqydfdaattlqflqkydlakhfklnl
    eanhatlaghtfehelrvaringalgsidanqgdlllgwdtdefptdlyastlamyeilq
    neggigrggvnfdakvrrtsfepidvvyahingmdafarglqvaakliedrafdnvieer
    yasftkgigadivsgkanfhtleayalqnnpitnksgrvellrsilnqyiinv