PDB entry 6inc

View 6inc on RCSB PDB site
Description: Crystal structure of an acetolactate decarboxylase from Klebsiella pneumoniae
Class: unknown function
Keywords: Acetolactate decarboxylase, UNKNOWN FUNCTION
Deposited on 2018-10-24, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-acetolactate decarboxylase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: budA, BN49_3166
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6inca_
  • Heterogens: ZN, CL, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6incA (A:)
    mnhsaectceeslcetlrafsaqhpesvlyqtslmsallsgvyegsttiadllkhgdfgl
    gtfneldgeliafssqvyqlradgsarnaqpeqktpfavmtwfqpqyrktfdhpvsrqql
    hevidqqipsdnlfcalridghfrhahtrtvprqtppyramtdvlddqpvfrfnqregvl
    vgfrtpqhmqginvagyhehfitddrkggghlldyqldhgvltfgeihklmidlpadsaf
    lqanlhpdnldaairsves
    

    Sequence, based on observed residues (ATOM records): (download)
    >6incA (A:)
    svlyqtslmsallsgvyegsttiadllkhgdfglgtfneldgeliafssqvyqlradgsa
    rnaqpeqktpfavmtwfqpqyrktfdhpvsrqqlhevidqqipsdnlfcalridghfrha
    htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
    kggghlldyqldhgvltfgeihklmidlpadsaflqan