PDB entry 6imf

View 6imf on RCSB PDB site
Description: Crystal structure of TOXIN/ANTITOXIN complex
Class: toxin/antitoxin
Keywords: complex, antitoxin, toxin-antitoxin complex, toxin
Deposited on 2018-10-22, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine-rich venom protein triflin
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6imfa1, d6imfa2
  • Chain 'B':
    Compound: Small serum protein 2
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6imfA (A:)
    nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh
    ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv
    wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksgppcgdcpsdcdnglct
    npctreneftncdslvqksscqdnymkskcpascfcqnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >6imfA (A:)
    vdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrcieshs
    srdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqivw
    yksyragcaaaycpsskysyfyvcqycpagniigktatpyksgppcgdcpsdcdnglctn
    pctreneftncdslvdnymkskcpascfcqnkii
    

  • Chain 'B':
    No sequence available.