PDB entry 6iin

View 6iin on RCSB PDB site
Description: USP14 catalytic domain with IU1-248
Class: hydrolase
Keywords: USP14 inhibitor complex, STRUCTURAL PROTEIN, HYDROLASE
Deposited on 2018-10-07, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iina_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iinb_
  • Heterogens: A8O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iinA (A:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
    dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied
    dsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfin
    qevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvn
    akvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevk
    yepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtp
    edilrlsgggdwhiayvllygprrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iinA (A:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
    dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiek
    slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk
    qsptlqrnalyiksskisrlpayltiqmvrffynakvlkdvkfplmldmyelctpelqek
    mvsfrskfkdlyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewik
    fdddkvsivtpedilrlsgggdwhiayvllygprrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iinB (B:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
    dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaied
    dsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfin
    qevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvn
    akvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevk
    yepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtp
    edilrlsgggdwhiayvllygprrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iinB (B:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlf
    dsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiek
    slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk
    qsptlqrnalyiksskisrlpayltiqmvrffynakvlkdvkfplmldmyelctpelqek
    mvsfrskfkdlepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf
    dddkvsivtpedilrlsgggdwhiayvllygprrv