PDB entry 6iik

View 6iik on RCSB PDB site
Description: USP14 catalytic domain with IU1
Class: hydrolase
Keywords: USP14 inhibitor complex, STRUCTURAL PROTEIN, HYDROLASE
Deposited on 2018-10-06, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iika_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iikb_
  • Heterogens: IU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iikA (A:)
    qlasamelpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaa
    lrdlfdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkl
    eaieddsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlql
    scfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffyke
    kesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkkssp
    qkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkv
    sivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iikA (A:)
    elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd
    smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedk
    slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk
    qsptlqrnalyiksskisrlpayltiqmvrffnakvlkdvkfplmldmyelctpelqekm
    vsfrskfkdlyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf
    dddkvsivtpedilrlsgggdwhiayvllygprrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iikB (B:)
    qlasamelpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaa
    lrdlfdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkl
    eaieddsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlql
    scfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffyke
    kesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkkssp
    qkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkv
    sivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iikB (B:)
    elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd
    smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedk
    slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk
    qsptlqrnalyiksskisrlpayltiqmvrffakvlkdvkfplmldmyelctpelqekmv
    sfrskfkkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdd
    dkvsivtpedilrlsgggdwhiayvllygprrve