PDB entry 6iij

View 6iij on RCSB PDB site
Description: Cryo-EM structure of CV-A10 mature virion
Class: viral protein
Keywords: Coxsackievirus A10, Mature virion, VIRAL PROTEIN
Deposited on 2018-10-06, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: EM
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iija_
  • Chain 'B':
    Compound: vp2
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iijb_
  • Chain 'C':
    Compound: vp3
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iijc_
  • Chain 'D':
    Compound: vp4
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SPH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iijA (A:)
    gdpvediihdalgntarraisgatnvesaadttpsshrletgrvpalqaaetgatsnatd
    enmietrcvinrngvlettinhffsrsglvgvvnltdggdttgyatwdidimgfvqlrrk
    cemftymrfnaeftfvtttksgearpymlqymyvppgapkptgrdafqwqtatnpsvfvk
    ltdppaqvsvpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsrea
    sqlklqtrvymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqanm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iijA (A:)
    dpvediihraisgatnvesaadttpsshrletgrvpalqaaetgatsnatdenmietrcv
    inrngvlettinhffsrsglvgvvnltdggdttgyatwdidimgfvqlrrkcemftymrf
    naeftfvtttksgearpymlqymyvppgapkptgrdafqwqtatnpsvfvkltdppaqvs
    vpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsreasqlklqtrv
    ymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iijB (B:)
    spsveacgysdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsv
    nrfytldskmwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqg
    allvavipefviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyp
    hqwvnlrtnncatvivpyinavpfdsainhsnfglvvvpvsplkyssgattaipititia
    plnsefgglrqavsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iijB (B:)
    sdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldsk
    mwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipe
    fviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwvnlrtn
    ncatvivpyinavpfdsainhsnfglvvvpvsplkyssgattaipititiaplnsefggl
    rqavsq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iijC (C:)
    gipaelrpgtnqflttdddtaapilpgftptptihipgevhsllelcrvetilevnntte
    atgltrllipvssqnkadelcaafmvdpgrigpwqstlvgqicryytqwsgslkvtfmft
    gsfmatgkmlvaysppgsaqpanretamlgthviwdfglqssvslvipwisnthfrtakt
    ggnydyytagvvtlwyqtnyvvppetpgeayiiamgaaqdnftlkickdtdevtqqavlq
    

  • Chain 'D':
    No sequence available.