PDB entry 6ii1

View 6ii1 on RCSB PDB site
Description: Crystal Structure Analysis of CO form hemoglobin from Bos taurus
Class: oxygen transport
Keywords: heme binding, iron ion binding, Red blood cells, globin family, OXYGEN TRANSPORT
Deposited on 2018-10-03, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ii1a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ii1b_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ii1c_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ii1d_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ii1A (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ii1A (A:)
    lsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghgak
    vaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpav
    hasldkflanvstvlts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ii1B (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ii1B (B:)
    ltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvka
    hgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgkef
    tpvlqadfqkvvagvanalahry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ii1C (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvlts
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ii1D (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh