PDB entry 6ihz

View 6ihz on RCSB PDB site
Description: The atomic structure of SHP2 E76A mutant
Class: hydrolase
Keywords: Phosphatase, HYDROLASE
Deposited on 2018-10-03, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (75)
    Domains in SCOPe 2.07: d6ihza1, d6ihza2, d6ihza3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (75)
    Domains in SCOPe 2.07: d6ihzb1, d6ihzb2, d6ihzb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ihzA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaalvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ihzA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpspgdftlsvrrngavthikiqntgdyydl
    yggekfatlaalvqyymehhgqlkedvielkyplncadptserwfhghlsgkeaekllte
    kgkhgsflvresqshpgdfvlsvrtgddgkskvthvmircqelkydvgggerfdsltdlv
    ehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqecklly
    srkegqrqenknknryknilpfdhtrvvlhdgdppvsdyinaniimpekksyiatqgclq
    ntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahd
    ytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpv
    vvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiy
    mavqhyietlqrrie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ihzB (B:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaalvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ihzB (B:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgd
    yydlyggekfatlaalvqyymehhgqlkegdvielkyplncadptserwfhghlsgkeae
    klltekgkhgsflvresqshpgdfvlsvrtgdgkskvthvmircqelkydvgggerfdsl
    tdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqec
    kllysrkegqrqenknknryknilpfdhtrvvlhdgdppvsdyinaniimpekksyiatq
    gclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkes
    aahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimd
    agpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqy
    rfiymavqhyietlqrrie