PDB entry 6ihe

View 6ihe on RCSB PDB site
Description: Crystal strcuture of Malate dehydrogenase from Metallosphaera sedula
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-09-29, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase (NAD)
    Species: METALLOSPHAERA SEDULA [TaxId:43687]
    Gene: Msed_0455
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ihea1, d6ihea2
  • Chain 'B':
    Compound: Malate dehydrogenase (NAD)
    Species: METALLOSPHAERA SEDULA [TaxId:43687]
    Gene: Msed_0455
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iheb1, d6iheb2
  • Heterogens: NAD, MLT, GOL, PGE, EDO, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iheA (A:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
    vdmmasvfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlws
    tvkikgkpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvm
    siatpkeyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqle
    qat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iheB (B:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
    vdmmasvfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlws
    tvkikgkpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvm
    siatpkeyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqle
    qat