PDB entry 6ihd

View 6ihd on RCSB PDB site
Description: Crystal strcuture of Malate dehydrogenase from Metallosphaera sedula
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-09-29, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Metallosphaera sedula [TaxId:43687]
    Gene: HA72_0455
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ihda1, d6ihda2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Metallosphaera sedula [TaxId:43687]
    Gene: HA72_0455
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ihdb1, d6ihdb2
  • Heterogens: NAD, ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ihdA (A:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
    vdmmasvfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlws
    tvkikgkpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvm
    siatpkeyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqle
    qatka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ihdA (A:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprrdlfvdnakimidlaqklpsknpgaiylmvanpvdmmas
    vfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlwstvkikg
    kpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvmsiatpk
    eyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqleqatka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ihdB (B:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
    vdmmasvfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlws
    tvkikgkpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvm
    siatpkeyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqle
    qatka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ihdB (B:)
    akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
    tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
    vdmmasvfmkyskqftisagdqvetmrmrsfiakklkipvtsvdgfvggehgedavvlws
    tvkikgkpvdefninkdevsdyvkkipgeiirviggttwgpgtiiadiiksiafsenrvm
    siatpkeyekeiihvsaptvvgssigpsleslldekdrwhlnsamkdfyeaykenlkqle
    qatk