PDB entry 6igo

View 6igo on RCSB PDB site
Description: Crystal structure of myelin protein zero-like protein 1 (MPZL1)
Class: membrane protein
Keywords: receptor, glycoprotein, transmembrane, immunoglobulin, MEMBRANE PROTEIN
Deposited on 2018-09-25, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igoa_
  • Chain 'B':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igob_
  • Chain 'C':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igoc_
  • Chain 'D':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igod_
  • Chain 'E':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igoe_
  • Chain 'F':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igof_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6igoA (A:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoA (A:)
    levytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvyl
    gnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6igoB (B:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoB (B:)
    evytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvylg
    nyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6igoC (C:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoC (C:)
    alevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvy
    lgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvve
    ke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6igoD (D:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoD (D:)
    levytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvyl
    gnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6igoE (E:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoE (E:)
    evytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvylg
    nyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6igoF (F:)
    salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqv
    ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvv
    ekenlpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igoF (F:)
    evytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvylg
    nyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek