PDB entry 6ige

View 6ige on RCSB PDB site
Description: Crystal structure of Human Papillomavirus type 33 pentamer
Class: structural protein
Keywords: capsid protein, STRUCTURAL PROTEIN
Deposited on 2018-09-25, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igea_
  • Chain 'B':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igeb_
  • Chain 'C':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igec_
  • Chain 'D':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6iged_
  • Chain 'E':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igee_
  • Chain 'F':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igef_
  • Chain 'G':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igeg_
  • Chain 'H':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igeh_
  • Chain 'I':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igei_
  • Chain 'J':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 33 [TaxId:10586]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 6IGE
    Domains in SCOPe 2.07: d6igej_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6igeA (A:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeA (A:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvasandcpplelintiiedgdmvdt
    gfgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnr
    agklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngi
    cwgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtlt
    aevmtyihamnpdiledwqfedplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6igeB (B:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeB (B:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptkllvpkvsglqyrvfrvrlpdp
    nkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypgqpg
    adnreclsmdykqtqlcllgckpptgehwgkgvandcpplelintiiedgdmvdtgfgcm
    dfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnragklg
    eavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnq
    vfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltaevmt
    yihamnpdiledwqfgedplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6igeC (C:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeC (C:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptkllvpkvsglqyrvfrvrlpdp
    nkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypgqpg
    adnreclsmdykqtqlcllgckpptgehwgkgvasndcpplelintiiedgdmvdtgfgc
    mdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnragkl
    geavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgn
    qvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltaevm
    tyihamnpdiledwqfdplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6igeD (D:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeD (D:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvasandcpplelintiiedgdmvdt
    gfgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnr
    agklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngi
    cwgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtlt
    aevmtyihamnpdiledwqfdplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6igeE (E:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeE (E:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaapandcpplelintiiedg
    dmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvr
    hffnragklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqg
    hnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlc
    kvtltaevmtyihamnpdiledwqfgltedplgkytfwevdlkekfsadldqfplgrkfl
    lqagl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6igeF (F:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeF (F:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptkkllvpkvsglqyrvfrvrlpd
    pnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypgqp
    gadnreclsmdykqtqlcllgckpptgehwgkgvasandcpplelintiiedgdmvdtgf
    gcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnrag
    klgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicw
    gnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltae
    vmtyihamnpdiledwqfedplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6igeG (G:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeG (G:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvandcpplelintiiedgdmvdtgf
    gcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnrag
    klgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicw
    gnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltae
    vmtyihamnpdiledwqfgledplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6igeH (H:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeH (H:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvasndcpplelintiiedgdmvdtg
    fgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnra
    gklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngic
    wgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtlta
    evmtyihamnpdiledwqfedplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6igeI (I:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeI (I:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknkllvpkvsglqyrvfrvrlpdpnk
    fgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypgqpgad
    nreclsmdykqtqlcllgckpptgehwgkgvastnaapandcpplelintiiedgdmvdt
    gfgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnr
    agklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngi
    cwgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtlt
    aevmtyihamnpdiledwqfgltdplgkytfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6igeJ (J:)
    msvwrpseatvylppvpvskvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakk
    llvpkvsglqyrvfrvrlpdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisg
    hpllnkfddtetgnkypgqpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaa
    pandcpplelintiiedgdmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtse
    pygdslffflrreqmfvrhffnragklgeavpddlyikgsgttasiqssaffptpsgsmv
    tsesqlfnkpywlqraqghnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfk
    eyirhveeydlqfvfqlckvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfv
    tsqaitcqktvppkekedplgkytfwevdlkekfsadldqfplgrkfllqaglkakpklk
    raaptstrtssakrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igeJ (J:)
    skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
    pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
    qpgadnreclsmdykqtqlcllgckpptgehwgkgvdcpplelintiiedgdmvdtgfgc
    mdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnragkl
    geavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgn
    qvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltaevm
    tyihamnpdiledwqfdplgkytfwevdlkekfsadldqfplgrkfllqagl