PDB entry 6if2

View 6if2 on RCSB PDB site
Description: Complex structure of Rab35 and its effector RUSC2
Class: endocytosis
Keywords: Rab35, RUSC2, complex, ENDOCYTOSIS
Deposited on 2018-09-18, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iporin
    Species: Homo sapiens [TaxId:9606]
    Gene: RUSC2, KIAA0375
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rab-35
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB35, RAB1C, RAY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15286 (6-End)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d6if2b_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6if2B (B:)
    gpgsefmardydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveing
    ekvklqiwdtaglerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvc
    rilvgnknddperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkd
    nlakqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6if2B (B:)
    mardydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklq
    iwdtaglerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgn
    knddperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnlak