PDB entry 6iey

View 6iey on RCSB PDB site
Description: Crystal structure of Chloramphenicol-Metabolizaing Enzyme EstDL136-Chloramphenicol complex
Class: hydrolase
Keywords: Chloramphenicol, metagenome, hornome sensitive lipase, HSL, EstDL136, esterase, hydrolase
Deposited on 2018-09-18, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estDL136
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3CR02 (0-306)
      • engineered mutation (152)
      • expression tag (305-313)
      • expression tag (307-308)
    Domains in SCOPe 2.07: d6ieya1, d6ieya2
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estDL136
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3CR02 (0-308)
      • engineered mutation (152)
      • expression tag (307-308)
    Domains in SCOPe 2.07: d6ieyb1, d6ieyb2
  • Heterogens: CLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ieyA (A:)
    mplnphveallqmmaqmpapdfsvanpaeiravfdnlaappqvarveniaisldgrdlda
    rlyvpedaderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyryp
    apaedcydalvwakqnaatlgvdgdrlavggdaaggnlaaavaimardrngpalrhqlli
    ypvtdndftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglap
    atvitaeydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergas
    nlkrdlalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ieyA (A:)
    mplnphveallqmmaqmpapaeiravfdnlaappqvarveniaisldgrdldarlyvped
    aderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyrypapaedcy
    dalvwakqnaatlgvdgdrlavggdaaggnlaaavaimardrngpalrhqlliypvtdnd
    ftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglapatvitae
    ydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergasnlkrdla
    lehhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ieyB (B:)
    mplnphveallqmmaqmpapdfsvanpaeiravfdnlaappqvarveniaisldgrdlda
    rlyvpedaderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyryp
    apaedcydalvwakqnaatlgvdgdrlavggdaaggnlaaavaimardrngpalrhqlli
    ypvtdndftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglap
    atvitaeydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergas
    nlkrdlalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ieyB (B:)
    mplnphveallqmmaqmpapdfsvanpaeiravfdnlaappqvarveniaisldgrdlda
    rlyvpedaderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyryp
    apaedcydalvwakqnaatlgvdgdrlavggdaaggnlaaavaimardrngpalrhqlli
    ypvtdndftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglap
    atvitaeydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergas
    nlkrdlale