PDB entry 6ien

View 6ien on RCSB PDB site
Description: Substrate/product bound Argininosuccinate lyase from Mycobacterium tuberculosis
Class: lyase
Keywords: arginine biosynthesis, tetramer, aspartase/fumarase, concerted movement, LYASE
Deposited on 2018-09-14, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iena_
  • Chain 'B':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ienb_
  • Chain 'C':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ienc_
  • Chain 'D':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iend_
  • Heterogens: AS1, FUM, EDO, PEG, ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ienA (A:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ienA (A:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgsspqkknpdiaelargksgrlignlagllatlkaq
    playnrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaew
    lvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsa
    rdcrggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ienB (B:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ienB (B:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
    aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
    ewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsv
    sardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ienC (C:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ienC (C:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
    aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
    ewlvrqgvpfrsahrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ienD (D:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ienD (D:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
    aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
    ewlvrqgvpfrsrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr