PDB entry 6iem

View 6iem on RCSB PDB site
Description: Argininosuccinate lyase from Mycobacterium tuberculosis
Class: lyase
Keywords: arginine biosynthesis, mycobacterium tuberculosis, tetramer, aspartase/fumarase, LYASE
Deposited on 2018-09-14, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iema_
  • Chain 'B':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemb_
  • Chain 'C':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemc_
  • Chain 'D':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemd_
  • Chain 'E':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ieme_
  • Chain 'F':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemf_
  • Chain 'G':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemg_
  • Chain 'H':
    Compound: Argininosuccinate Lyase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: argH, Rv1659, MTCY06H11.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iemh_
  • Heterogens: GOL, EDO, PG4, P3G, 2PE, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iemA (A:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemA (A:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgpqkknpdiaelargksgrlignlagllatlkaqpl
    aynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaewlv
    rqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsard
    crggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iemB (B:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemB (B:)
    slwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllag
    ldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwl
    rdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdld
    rivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafv
    famiavdlsrlaediivwsstefgyvtlhdswstgimpqkknpdiaelargksgrlignl
    agllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapag
    ytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvre
    vltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6iemC (C:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemC (C:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgpqkknpdiaelargksgrlignlagllatlkaqpl
    aynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaewlv
    rqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsard
    crggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6iemD (D:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemD (D:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
    aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
    ewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsv
    sardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6iemE (E:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemE (E:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgkknpdiaelargksgrlignlagllatlkaqplay
    nrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaewlvrq
    gvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsardcr
    ggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6iemF (F:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemF (F:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgpqkknpdiaelargksgrlignlagllatlkaqpl
    aynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaewlv
    rqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsard
    crggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6iemG (G:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemG (G:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgskknpdiaelargksgrlignlagllatlkaqpla
    ynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdlaewlvr
    qgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsvsardc
    rggtapgrvaeqlnaigeaaerlrrqlvr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6iemH (H:)
    mstnegslwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqr
    dgllagldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaa
    lfrmwlrdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahp
    llrdldrivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfa
    aeaafvfamiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargk
    sgrlignlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqr
    maelapagytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaisp
    eltpqvrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iemH (H:)
    psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
    gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
    vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
    vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
    laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
    aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
    ewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsv
    sardcrggtapgrvaeqlnaigeaaerlrrqlvr