PDB entry 6idh

View 6idh on RCSB PDB site
Description: Antibody 64M-5 Fab in ligand-free form
Class: immune system
Keywords: DNA (6-4) photoproduct, immunoglobulin, fab, immune system
Deposited on 2018-09-10, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Anti-(6-4) photoproduct antibody 64M-5 Fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IDH (0-220)
  • Chain 'L':
    Compound: Anti-(6-4) photoproduct antibody 64M-5 Fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IDH (0-216)
    Domains in SCOPe 2.07: d6idhl1, d6idhl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6idhL (L:)
    dvlmtqtplslpvslgdqasiscrssqnivhsngytylewylqkpgqspklliytvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfrgshvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne