PDB entry 6id0

View 6id0 on RCSB PDB site
Description: Cryo-EM structure of a human intron lariat spliceosome prior to Prp43 loaded (ILS1 complex) at 2.9 angstrom resolution
Class: splicing
Keywords: Human Intron Lariat Spliceosome, SPLICING
Deposited on 2018-09-07, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: EM
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-processing-splicing factor 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: U5snRNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'C':
    Compound: 116 kDa U5 small nuclear ribonucleoprotein component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5
  • Chain 'E':
    Compound: U5 small nuclear ribonucleoprotein 40 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0e_
  • Chain 'F':
    Compound: U6snRNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'G':
    Compound: pre-mRNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'H':
    Compound: U2snRNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'I':
    Compound: Pre-mRNA-splicing factor SYF1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Crooked neck-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Pre-mRNA-splicing factor SPF27
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Cell division cycle 5-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Pre-mRNA-splicing factor SYF2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Protein BUD31 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0n_
  • Chain 'O':
    Compound: Pre-mRNA-splicing factor RBM22
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Spliceosome-associated protein CWC15 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: RNA helicase aquarius
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: SNW domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: peptidyl-prolyl cis-trans isomerase-like 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0s_
  • Chain 'T':
    Compound: Pleiotropic regulator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0t_
  • Chain 'U':
    Compound: CWF19-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Pre-mRNA-processing factor 17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0a_
  • Chain 'b':
    Compound: Small nuclear ribonucleoprotein-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0b_
  • Chain 'c':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0d_
  • Chain 'e':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0f_
  • Chain 'g':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0g_
  • Chain 'h':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0h_
  • Chain 'i':
    Compound: Small nuclear ribonucleoprotein-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0i_
  • Chain 'j':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0j_
  • Chain 'k':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0k_
  • Chain 'l':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0l_
  • Chain 'm':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0m_
  • Chain 'n':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: U2 small nuclear ribonucleoprotein A'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0o_
  • Chain 'p':
    Compound: U2 small nuclear ribonucleoprotein B''
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0p_
  • Chain 'q':
    Compound: Pre-mRNA-processing factor 19
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0q1, d6id0q2
  • Chain 'r':
    Compound: Pre-mRNA-processing factor 19
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0r1, d6id0r2
  • Chain 's':
    Compound: Pre-mRNA-processing factor 19
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Pre-mRNA-processing factor 19
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6id0y_
  • Heterogens: I6P, GTP, MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6id0C (C:)
    mdtdlydefgnyigpeldsdedddelgretkdldemddddddddvgdhdddhpgmevvlh
    edkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvyemdfla
    dlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteqergvg
    ikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegvmlnte
    rlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystdenlil
    spllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrkftkka
    ptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpllrlvc
    kkffgeftgfvdmcvqhipspkvgakpkiehtytggvdsdlgeamsdcdpdgplmchttk
    mystddgvqfhafgrvlsgtihagqpvkvlgenytledeedsqictvgrlwisvaryhie
    vnrvpagnwvliegvdqpivktatiteprgneeaqifrplkfnttsvikiavepvnpsel
    pkmldglrkvnksypslttkveesgehvilgtgelyldcvmhdlrkmyseidikvadpvv
    tfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffqt
    kydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregplc
    delirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlmepyyfvevqapa
    dcvsavytvlarrrghvtqdapipgsplytikafipaidsfgfetdlrthtqgqafslsv
    fhhwqivpgdpldksivirplepqpaphlarefmiktrrrkglsedvsiskffddpmlle
    lakqdvvlnypm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0C (C:)
    evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye
    mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq
    ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv
    mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd
    enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk
    ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl
    lrlvckkffgeftgfvdmcvqhipspkvgakpkiehtytggvdsdlgeamsdcdpdgplm
    chttkmystddgvqfhafgrvlsgtihagqpvkvlgenytledeedsqictvgrlwisva
    ryhievnrvpagnwvliegvdqpivktatiteprgneeaqifrplkfnttsvikiavepv
    npselpkmldglrkvnksypslttkveesgehvilgtgelyldcvmhdlrkmyseidikv
    adpvvtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklg
    effqtkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtr
    egplcdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlmepyyfve
    vqapadcvsavytvlarrrghvtqdapipgsplytikafipaidsfgfetdlrthtqgqa
    fslsvfhhwqivpgdpldksivirplepqpaphlarefmiktrrrkgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6id0E (E:)
    mieqqkrkgpelplvpvkrqrhelllgagsgpgagqqqatpgallqagpprcsslqapim
    llsghegevycckfhpngstlasagfdrlillwnvygdcdnyatlkghsgavmelhyntd
    gsmlfsastdktvavwdsetgervkrlkghtsfvnscyparrgpqlvctgsddgtvklwd
    irkkaaiqtfqntyqvlavtfndtsdqiisggidndikvwdlrqnkltytmrghadsvtg
    lslssegsyllsnamdntvrvwdvrpfapkercvkifqgnvhnfeknllrcswspdgski
    aagsadrfvyvwdttsrrilyklpghagsinevafhpdepiiisassdkrlymgeiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0E (E:)
    slqapimllsghegevycckfhpngstlasagfdrlillwnvygdcdnyatlkghsgavm
    elhyntdgsmlfsastdktvavwdsetgervkrlkghtsfvnscyparrgpqlvctgsdd
    gtvklwdirkkaaiqtfqntyqvlavtfndtsdqiisggidndikvwdlrqnkltytmrg
    hadsvtglslssegsyllsnamdntvrvwdvrpfapkercvkifqgnvhnfeknllrcsw
    spdgskiaagsadrfvyvwdttsrrilyklpghagsinevafhpdepiiisassdkrlym
    gei
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6id0N (N:)
    mpkvkrsrkappdgwelieptldeldqkmreaetephegkrkveslwpifrihhqktryi
    fdlfykrkaisrelyeycikegyadknliakwkkqgyenlcclrciqtrdtnfgtncicr
    vpksklevgriiecthcgcrgcsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0N (N:)
    mpkvkrsrkappdgwelieptldeldqkmreaetephegkrkveslwpifrihhqktryi
    fdlfykrkaisrelyeycikegyadknliakwkkqgyenlcclrciqtrdtnfgtncicr
    vpksklevgriiecthcgcrgcs
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6id0S (S:)
    maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
    miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
    wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0S (S:)
    swqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmiqggdp
    tgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwldgkht
    ifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6id0T (T:)
    mveevqkhsvhtlvfrslkrthdmfvadngkpvpldeeshkrkmaiklrneygpvlhmpt
    skenlkekgpqnatdsyvhkqypanqgqeveyfvagthpyppgpgvaltadtkiqrmpse
    saaqslavalplqtkadanrtapsgseyrhpgasdrpqptamnsivmetgntknsalmak
    kaptmpkpqwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklkl
    sltghistvrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhpti
    dvlvtcsrdstariwdvrtkasvhtlsghtnavatvrcqaaepqiitgshdttirlwdlv
    agktrvtltnhkksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintlt
    vnsdgvlvsgadngtmhlwdwrtgynfqrvhaavqpgsldsesgifacafdqsesrllta
    eadktikvyreddtateethpvswkpeiikrkrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0T (T:)
    tmpkpqwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklklslt
    ghistvrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhptidvl
    vtcsrdstariwdvrtkasvhtlsghtnavatvrcqaaepqiitgshdttirlwdlvagk
    trvtltnhkksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintltvns
    dgvlvsgadngtmhlwdwrtgynfqrvhaavqpgsldsesgifacafdqsesrlltaead
    ktikvyreddtateeth
    

  • Chain 'U':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >6id0a (a:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgskirflilpdmlknapmlksmknknqgsgagrgkaailkaqvaargrgrgmgrgn
    ifqkrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0a (a:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgskirflilpdmlknmlks
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >6id0b (b:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtgiarvplagaaggpgigraagrgipagvpm
    pqapaglagpvrgvggpsqqvmtpqgrgtvaaaaaaatasiagaptqyppgrggppppmg
    rgapppgmmgpppgmrppmgppmgippgrgtpmgmpppgmrppppgmrgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0b (b:)
    gksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaeree
    krvlglvllrgenlvsmtvegpppkd
    

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    Sequence, based on SEQRES records: (download)
    >6id0d (d:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0d (d:)
    eeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpk
    sgkgkkkskpvnkdryiskmflrgdsvivvlrnplia
    

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >6id0f (f:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0f (f:)
    slplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlge
    vlircnnvlyirgv
    

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >6id0g (g:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0g (g:)
    kahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvi
    rgnsiimlealerv
    

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >6id0h (h:)
    msigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleq
    vyirgskirflilpdmlknapmlksmknknqgsgagrgkaailkaqvaargrgrgmgrgn
    ifqkrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0h (h:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgskirflilpdmlknmlks
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >6id0i (i:)
    mtvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqae
    reekrvlglvllrgenlvsmtvegpppkdtgiarvplagaaggpgigraagrgipagvpm
    pqapaglagpvrgvggpsqqvmtpqgrgtvaaaaaaatasiagaptqyppgrggppppmg
    rgapppgmmgpppgmrppmgppmgippgrgtpmgmpppgmrppppgmrgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0i (i:)
    gksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaeree
    krvlglvllrgenlvsmtvegpppkd
    

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >6id0j (j:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0j (j:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvd
    

  • Chain 'k':
    Sequence, based on SEQRES records: (download)
    >6id0k (k:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0k (k:)
    eeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtepvn
    kdryiskmflrgdsvivvlrnplia
    

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >6id0l (l:)
    mayrgqgqkvqkvmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvldd
    aeeihsktksrkqlgrimlkgdnitllqsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0l (l:)
    mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq
    lgrimlkgdnitllqsvsn
    

  • Chain 'm':
    Sequence, based on SEQRES records: (download)
    >6id0m (m:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0m (m:)
    slplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlge
    vlircnnvlyirgv
    

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >6id0o (o:)
    mvkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgf
    pllrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsi
    lrnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdiarrskt
    fnpgaglptdkkkggpspgdveaiknaianastlaeverlkgllqsgqipgrerrsgptd
    dgeeemeedtvtngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0o (o:)
    vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
    llrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsil
    rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
    

  • Chain 'p':
    Sequence, based on SEQRES records: (download)
    >6id0p (p:)
    mdirpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelg
    sstnalrqlqgfpfygkpmriqyaktdsdiiskmrgtfadkekkkekkkaktveqtattt
    nkkpgqgtpnsantqgnstpnpqvpdyppnyilflnnlpeetnemmlsmlfnqfpgfkev
    rlvpgrhdiafvefendgqagaardalqgfkitpshamkityakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0p (p:)
    irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
    tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
    

  • Chain 'q':
    Sequence, based on SEQRES records: (download)
    >6id0q (q:)
    mslicsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvahp
    irpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviarl
    tkevtaarealatlkpqaglivpqavpssqpsvvgagepmdlgelvgmtpeiiqklqdka
    tvltterkkrgktvpeelvkpeelskyrqvashvglhsasipgilaldlcpsdtnkiltg
    gadknvvvfdksseqilatlkghtkkvtsvvfhpsqdlvfsaspdatiriwsvpnascvq
    vvrahesavtglslhatgdyllsssddqywafsdiqtgrvltkvtdetsgcsltcaqfhp
    dglifgtgtmdsqikiwdlkertnvanfpghsgpitsiafsengyylataaddssvklwd
    lrklknfktlqldnnfevkslifdqsgtylalggtdvqiyickqwteilhftehsglttg
    vafghhakfiastgmdrslkfysl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0q (q:)
    licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvahpir
    pkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviarltk
    evtaarealatl
    

  • Chain 'r':
    Sequence, based on SEQRES records: (download)
    >6id0r (r:)
    mslicsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvahp
    irpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviarl
    tkevtaarealatlkpqaglivpqavpssqpsvvgagepmdlgelvgmtpeiiqklqdka
    tvltterkkrgktvpeelvkpeelskyrqvashvglhsasipgilaldlcpsdtnkiltg
    gadknvvvfdksseqilatlkghtkkvtsvvfhpsqdlvfsaspdatiriwsvpnascvq
    vvrahesavtglslhatgdyllsssddqywafsdiqtgrvltkvtdetsgcsltcaqfhp
    dglifgtgtmdsqikiwdlkertnvanfpghsgpitsiafsengyylataaddssvklwd
    lrklknfktlqldnnfevkslifdqsgtylalggtdvqiyickqwteilhftehsglttg
    vafghhakfiastgmdrslkfysl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0r (r:)
    licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvahpir
    pkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviarltk
    evtaarealat
    

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'y':
    Sequence, based on SEQRES records: (download)
    >6id0y (y:)
    mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
    aaaidnmneselfgrtirvnlakpmrikegssrpvwsdddwlkkfsgktleenkeeegse
    ppkaetqegepiakkarsnpqvymdikignkpagriqmllrsdvvpmtaenfrclcthek
    gfgfkgssfhriipqfmcqggdftnhngtggksiygkkfddenfilkhtgpgllsmansg
    pntngsqffltcdktdwldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgey
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >6id0y (y:)
    krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai
    dnmneselfgrtirvnlak