PDB entry 6icg
View 6icg on RCSB PDB site
Description: Grb2 SH2 domain in phosphopeptide free form
Class: signaling protein
Keywords: Src homology 2 domain, phosphorylated tyrosine, Adapter protein, SIGNALING PROTEIN
Deposited on
2018-09-06, released
2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-07-17, with a file datestamp of
2019-07-12.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6icga1, d6icga2 - Chain 'B':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6icgb1, d6icgb2 - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6icgA (A:)
gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdie
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6icgB (B:)
gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdie