PDB entry 6ibe

View 6ibe on RCSB PDB site
Description: The FERM domain of Human EPB41L3
Class: cell adhesion
Keywords: Ferm domain, Alzheimer's Disease, CELL ADHESION
Deposited on 2018-11-29, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Band 4.1-like protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: EPB41L3, DAL1, KIAA0987
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ibea1, d6ibea2, d6ibea3
  • Heterogens: EDO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ibeA (A:)
    smpksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknw
    ldpakeikkqvrsgawhfsfnvkfyppdpaqlseditryylclqlrddivsgrlpcsfvt
    lallgsytvqselgdydpdecgsdyisefrfapnhtkeledkvielhkshrgmtpaeaem
    hflenakklsmygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykr
    nnfyikirpgefeqfestigfklpnhraakrlwkvcvehhtffrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ibeA (A:)
    pksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwld
    pakeikkqvrsgawhfsfnvkfyppdpaqlseditryylclqlrddivsgrlpcsfvtla
    llgsytvqselgdydpdecgsdyisefrfapnhtkeledkvielhkshrgmtpaeaemhf
    lenakklsmygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnn
    fyikirpgefeqfestigfklpnhraakrlwkvcvehhtffrll