PDB entry 6i8s

View 6i8s on RCSB PDB site
Description: Discovery and characterisation of an antibody that selectively modulates the inhibitory activity of plasminogen activator inhibitor-1
Class: blood clotting
Keywords: serpin, plasminogen activator inhibitor-1, pai-1, antibody, fab, blood clotting
Deposited on 2018-11-21, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.07: d6i8sa_
  • Chain 'B':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.07: d6i8sb_
  • Chain 'C':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.07: d6i8sc_
  • Chain 'D':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.07: d6i8sd_
  • Chain 'E':
    Compound: heavy chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
  • Chain 'F':
    Compound: heavy chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
  • Chain 'G':
    Compound: heavy chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
  • Chain 'H':
    Compound: heavy chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
  • Chain 'I':
    Compound: light chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
    Domains in SCOPe 2.07: d6i8si1, d6i8si2
  • Chain 'J':
    Compound: light chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
    Domains in SCOPe 2.07: d6i8sj1, d6i8sj2
  • Chain 'K':
    Compound: light chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
    Domains in SCOPe 2.07: d6i8sk1, d6i8sk2
  • Chain 'L':
    Compound: light chain of fab fragment from an pai-1 antibody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8S (0-End)
    Domains in SCOPe 2.07: d6i8sl1, d6i8sl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i8sA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sA (A:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvalalqkvkievnesgtarmapeeiiidrpflfvvrhnptgtvlfmgqv
    mep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i8sB (B:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sB (B:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvalalqkvkievnesgtarmapeeiiidrpflfvvrhnptgtvlfmgqv
    mep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6i8sC (C:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sC (C:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvalalqkvkievnesgtarmapeeiiidrpflfvvrhnptgtvlfmgqv
    mep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6i8sD (D:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sD (D:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvalalqkvkievnesgtarmapeeiiidrpflfvvrhnptgtvlfmgqv
    mep
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6i8sI (I:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sI (I:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6i8sJ (J:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sJ (J:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6i8sK (K:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sK (K:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6i8sL (L:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8sL (L:)
    diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
    rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr