PDB entry 6i8n

View 6i8n on RCSB PDB site
Description: Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-amino-L-phenylalanine
Class: DNA binding protein
Keywords: PadR family, transcriptional regulator, engineered variant, artificial enzyme, unnatural amino acid, DNA BINDING PROTEIN
Deposited on 2018-11-20, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris (strain MG1363) [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2RI36 (0-End)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d6i8na_
  • Chain 'B':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris (strain MG1363) [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2RI36
      • engineered mutation (14)
    Domains in SCOPe 2.07: d6i8nb_
  • Heterogens: HOX, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i8nA (A:)
    maeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaiksrws
    hpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8nA (A:)
    maeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdgrrkyyrlteighenmrlafeswsrvdkiienleankk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i8nB (B:)
    maeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaiksrws
    hpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8nB (B:)
    aeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdg
    iissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseai