PDB entry 6i6z

View 6i6z on RCSB PDB site
Description: Crystal structure of the human CARBOXYPEPTIDASE A1 in complex with the PHOSPHINIC INHIBITOR Acetyl-Tyr-Ala-Y(PO2CH2)-homoPhe-OH
Class: hydrolase
Keywords: Protease, HYDROLASE
Deposited on 2018-11-15, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: CPA1, CPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15085 (Start-307)
      • expression tag (308-309)
    Domains in SCOPe 2.07: d6i6za1, d6i6za2
  • Chain 'B':
    Compound: Carboxypeptidase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: CPA1, CPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15085 (Start-307)
      • expression tag (308-309)
    Domains in SCOPe 2.07: d6i6zb1, d6i6zb2
  • Heterogens: TJE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i6zA (A:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhpxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i6zA (A:)
    stdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpai
    widtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafthst
    nrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivdf
    vkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnygs
    iikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltime
    htlnhpxx
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i6zB (B:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhpxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i6zB (B:)
    rstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpa
    iwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafths
    tnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivd
    fvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnyg
    siikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltim
    ehtlnhpxx