PDB entry 6hwz

View 6hwz on RCSB PDB site
Description: Selenols: a new class of Carbonic Anhydrase inhibitors
Class: lyase
Keywords: lyase
Deposited on 2018-10-15, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hwza_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hwzb_
  • Heterogens: ZN, GXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hwzA (A:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hwzA (A:)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hwzB (B:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hwzB (B:)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf