PDB entry 6hvd

View 6hvd on RCSB PDB site
Description: Human SLK bound to a maleimide inhibitor
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2018-10-10, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ste20-like serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: SLK, KIAA0204, STK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2G2 (2-End)
      • expression tag (1)
      • conflict (8)
    Domains in SCOPe 2.07: d6hvda1, d6hvda2
  • Heterogens: GUQ, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hvdA (A:)
    smkqyehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledy
    mveidilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvc
    kqtldalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpyw
    mapevvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptla
    qpsrwssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeakaevteeve
    dgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hvdA (A:)
    mkqyehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledym
    veidilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvck
    qtldalnylhdnkiihrdlkagnilftldgdikladfgvsakntrsfigtpywmapevvm
    cetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsrwss
    nfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeaka