PDB entry 6hv1

View 6hv1 on RCSB PDB site
Description: The structure of Dps from Listeria innocua soaked before soaking experiments with Zn, Co and La
Class: metal binding protein
Keywords: Dps, metal binding. cage shaped protein, ferroxidase, itron translocation, METAL BINDING PROTEIN
Deposited on 2018-10-10, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1a_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1b_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1c_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1d_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1e_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, NCTC12210_00273
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hv1f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hv1A (A:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1A (A:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hv1B (B:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1B (B:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hv1C (C:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1C (C:)
    dtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hv1D (D:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1D (D:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hv1E (E:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1E (E:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hv1F (F:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hv1F (F:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple