PDB entry 6hu7

View 6hu7 on RCSB PDB site
Description: phosphorylated F97L Hepatitis B core protein capsid
Class: virus like particle
Keywords: Hapatitis B core protein Hbc Hbcag, VIRUS LIKE PARTICLE premature envelopment mutant phosphorylated F97L, VIRUS LIKE PARTICLE
Deposited on 2018-10-05, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EYZ6 (0-End)
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6hu7a_
  • Chain 'B':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EYZ6 (0-End)
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6hu7b_
  • Chain 'C':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EYZ6 (0-End)
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6hu7c_
  • Chain 'D':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EYZ6 (0-End)
      • engineered mutation (96)
    Domains in SCOPe 2.07: d6hu7d_
  • Chain 'F':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: capsid protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hu7A (A:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hu7A (A:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpett
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hu7B (B:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hu7B (B:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hu7C (C:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hu7C (C:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hu7D (D:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hu7D (D:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglklrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.