PDB entry 6htx

View 6htx on RCSB PDB site
Description: WT Hepatitis B core protein capsid
Class: virus like particle
Keywords: Hapatitis B core protein Hbc Hbcag, VIRUS LIKE PARTICLE
Deposited on 2018-10-05, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: EM
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Hepatitis B virus ayw/France/Tiollais/1979 [TaxId:490133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6htxa_
  • Chain 'B':
    Compound: capsid protein
    Species: Hepatitis B virus ayw/France/Tiollais/1979 [TaxId:490133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6htxb_
  • Chain 'C':
    Compound: capsid protein
    Species: Hepatitis B virus ayw/France/Tiollais/1979 [TaxId:490133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6htxc_
  • Chain 'D':
    Compound: capsid protein
    Species: Hepatitis B virus ayw/France/Tiollais/1979 [TaxId:490133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6htxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6htxA (A:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6htxA (A:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6htxB (B:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6htxB (B:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6htxC (C:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6htxC (C:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpet
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6htxD (D:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrrrgrsprrrtpsprrrrsqsprrrrsqsre
    sqc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6htxD (D:)
    mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
    cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv
    sfgvwirtppayrppnapilstlpettvvrr