PDB entry 6hrl

View 6hrl on RCSB PDB site
Description: Crystal structure of the Kelch domain of human KLHL17
Class: ligase
Keywords: Kelch domain, Cullin 3 E3 ligase substrate adaptor, Actinfilin, Homo sapiens, ubiquitination, LIGASE
Deposited on 2018-09-27, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like protein 17
    Species: Homo sapiens [TaxId:9606]
    Gene: KLHL17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hrla_
  • Chain 'B':
    Compound: Kelch-like protein 17
    Species: Homo sapiens [TaxId:9606]
    Gene: KLHL17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hrlb_
  • Heterogens: SO4, CL, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hrlA (A:)
    gagpvlfavgggslfaihgdceaydtrtdrwhvvasmstrrarvgvaavgnrlyavggyd
    gtsdlatvesydpvtntwqpevsmgtrrsclgvaalhgllysaggydgasclnsaerydp
    ltgtwtsvaamstrrryvrvatldgnlyavggydssshlatvekyepqvnvwspvasmls
    rrssagvavlegalyvaggndgtsclnsveryspkagawesvapmnirrsthdlvamdgw
    lyavggndgssslnsiekynprtnkwvaascmftrrssvgvavlell
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hrlB (B:)
    gagpvlfavgggslfaihgdceaydtrtdrwhvvasmstrrarvgvaavgnrlyavggyd
    gtsdlatvesydpvtntwqpevsmgtrrsclgvaalhgllysaggydgasclnsaerydp
    ltgtwtsvaamstrrryvrvatldgnlyavggydssshlatvekyepqvnvwspvasmls
    rrssagvavlegalyvaggndgtsclnsveryspkagawesvapmnirrsthdlvamdgw
    lyavggndgssslnsiekynprtnkwvaascmftrrssvgvavlell