PDB entry 6hoj

View 6hoj on RCSB PDB site
Description: Structure of Beclin1 LIR motif bound to GABARAP
Class: signaling protein
Keywords: Autophagy, ATG8, LIR, SIGNALING PROTEIN
Deposited on 2018-09-17, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beclin-1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14457 (Start-12)
      • linker (13-14)
    • Uniprot O95166 (15-126)
    Domains in SCOPe 2.07: d6hoja_
  • Chain 'B':
    Compound: Beclin-1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hojb_
  • Chain 'C':
    Compound: Beclin-1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14457 (Start-12)
      • linker (13-14)
    • Uniprot O95166 (15-126)
    Domains in SCOPe 2.07: d6hojc_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hojA (A:)
    sansftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hojA (A:)
    sftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkk
    ylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyia
    ysde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hojB (B:)
    sansftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hojB (B:)
    nsftligeassmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkky
    lvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiay
    sde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hojC (C:)
    sansftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hojC (C:)
    sftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkk
    ylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyia
    ysde