PDB entry 6hoh

View 6hoh on RCSB PDB site
Description: Structure of VPS34 LIR motif (S249E) bound to GABARAP
Class: signaling protein
Keywords: Autophagy, ATG8, LIR, SIGNALING PROTEIN
Deposited on 2018-09-17, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (Start-14)
      • engineered mutation (5)
      • linker (15-16)
    • Uniprot O95166 (17-128)
    Domains in SCOPe 2.07: d6hoha_
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (0-14)
      • engineered mutation (5)
      • linker (15-16)
    • Uniprot O95166 (17-128)
    Domains in SCOPe 2.07: d6hohb_
  • Chain 'C':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (Start-14)
      • engineered mutation (5)
      • linker (15-16)
    • Uniprot O95166 (17-128)
    Domains in SCOPe 2.07: d6hohc_
  • Chain 'D':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9
      • engineered mutation (5)
      • linker (16)
    • Uniprot O95166 (17-128)
    Domains in SCOPe 2.07: d6hohd_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hohA (A:)
    spiltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigd
    ldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedf
    flyiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hohA (A:)
    ltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldk
    kkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffly
    iaysde
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hohB (B:)
    spiltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigd
    ldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedf
    flyiaysde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hohC (C:)
    spiltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigd
    ldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedf
    flyiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hohC (C:)
    iltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hohD (D:)
    spiltefelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigd
    ldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedf
    flyiaysde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hohD (D:)
    ltefelvkvpdsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkk
    ylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyia
    ysde