PDB entry 6hmw

View 6hmw on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with fucose
Class: toxin
Keywords: Toxin, cholera toxin, lectin, complex, fucose, protein-carbohydrate interactions, X-ray crystal structure
Deposited on 2018-09-13, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwa_
  • Chain 'B':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwb_
  • Chain 'C':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwc_
  • Chain 'D':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwd_
  • Chain 'E':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwe_
  • Chain 'F':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwf_
  • Chain 'G':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwg_
  • Chain 'H':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwh_
  • Chain 'I':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwi_
  • Chain 'J':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmwj_
  • Heterogens: FUL, CA, BCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwA (A:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwB (B:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwC (C:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwF (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >6hmwG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

    Sequence, based on observed residues (ATOM records): (download) 
    >6hmwG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisma

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwH (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwI (I:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmwJ (J:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman