PDB entry 6hmn

View 6hmn on RCSB PDB site
Description: polyadpribosyl glycosidase in complex with pdd00014909
Class: hydrolase
Keywords: hydrolase, competitive inhibitor
Deposited on 2018-09-12, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: parG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86W56
      • engineered mutation (170-172)
      • engineered mutation (242-244)
    Domains in SCOPe 2.07: d6hmna_
  • Heterogens: 70J, DMS, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmnA (A:)
    gsspdkkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdl
    wdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvays
    kkwdftalidfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitm
    sqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrr
    vtaaaptglvtftrqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgg
    gvtsaglvqeeirflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrsh
    edgserddwqrrcteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsav
    atgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltv
    gdvyklllryyneecrncstpgpdiklypfiyhavescaetadhsgqrtgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmnA (A:)
    dkkwlgtpieemrrmprlpllrpsanhtvtirvdllragevpkpfpthykdlwdnkhvkm
    pcseqnlypvedtagsrweliqtallnkftrpqnlkdailkynvayskkwdftalidfwd
    kvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeqiasllanaf
    fctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtaaaptglvtft
    rqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvtsaglvqeeir
    flinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgserddwqrrc
    teivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgnwgcgafggd
    arlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvyklllryyne
    ecrncstpgpdiklypfiyhavesc