PDB entry 6hm6

View 6hm6 on RCSB PDB site
Description: crystal structure of spleen tyrosine kinase (syk) in complex with a 2-(pyridinyloxymethyl)pyridine inhibitor
Class: transferase
Keywords: SK363, SYK, non-receptor tyrosine kinase, spleen tyrosine kinase, TRANSFERASE
Deposited on 2018-09-12, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spleen tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hm6a_
  • Heterogens: GDK, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hm6A (A:)
    pkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdella
    eanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvs
    mgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwy
    apecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpr
    emydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hm6A (A:)
    yldrklltledkelgsgnfgtvkkgyyqmkvvktvavkildpalkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqgkwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrnyyyd