PDB entry 6hly

View 6hly on RCSB PDB site
Description: Structure in P212121 form of the PBP AgtB in complex with agropinic acid from A.tumefacien R10
Class: transport protein
Keywords: periplasmic binding protein, ABC transporter, TRANSPORT PROTEIN
Deposited on 2018-09-11, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agropine permease
    Species: Agrobacterium tumefaciens LBA4213 (Ach5) [TaxId:1435057]
    Gene: agtB, X971_5368
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8FRA6 (22-334)
      • expression tag (19-21)
      • expression tag (335-338)
    Domains in SCOPe 2.07: d6hlya1, d6hlya2, d6hlya3
  • Heterogens: EDO, G9Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hlyA (A:)
    mgsshhhhhhssglvprgshmmadlvissyggsfqdaqtkayfdpyakasgvkvtgttgt
    gyakvkamvesgnvtwdvisaespafasevkdgllepidysvvkadnvpenfrtkygvgy
    mvfgtnlawnkdkfpngvtpaqffdpnvkgrrvlpsdatyslefalmgdgvkpadlypld
    vkralkvidrvkdqvigykgasdiqalmqqgeadivyagtgriknaikaganwsyswega
    ladteywavpkgaphaaeamkfinfavqaepqaeltrviaygptnvdalrlldpavakdl
    psypanaklgavlnskwwndnydavkaewttyimqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hlyA (A:)
    hmmadlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvi
    saespafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvt
    paqffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigyk
    gasdiqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaea
    mkfinfavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwn
    dnydavkaewttyimqhhhh