PDB entry 6hl8

View 6hl8 on RCSB PDB site
Description: Crystal Structure of the CsiD Glutarate Hydroxylase in complex with Glutarate
Class: hydrolase
Keywords: jelly roll, glutarate hydroxylase, alpha-ketoglutarate-dependent, HYDROLASE
Deposited on 2018-09-10, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CsiD
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: csiD, gab, ygaT, b2659, JW5427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hl8a_
  • Chain 'B':
    Compound: Protein CsiD
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: csiD, gab, ygaT, b2659, JW5427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hl8b_
  • Heterogens: FE2, GUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hl8A (A:)
    mgsshhhhhhssglvprgshmnaltavqnnavdsgqdysgftltpsaqsprlleltfteq
    ttkqfleqvaewpvqaleyksflrfrvakilddlcanqlqplllktllnraegallinav
    gvddvkqademvklatavahligrsnfdamsgqyyarfvvknvdnsdsylrqphrvmelh
    ndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhplarrpmrfaappsk
    nvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvpvpvg
    kfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hl8A (A:)
    qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
    anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
    arfvvkhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpl
    arrpmrfaakdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgils
    vpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hl8B (B:)
    mgsshhhhhhssglvprgshmnaltavqnnavdsgqdysgftltpsaqsprlleltfteq
    ttkqfleqvaewpvqaleyksflrfrvakilddlcanqlqplllktllnraegallinav
    gvddvkqademvklatavahligrsnfdamsgqyyarfvvknvdnsdsylrqphrvmelh
    ndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhplarrpmrfaappsk
    nvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvpvpvg
    kfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hl8B (B:)
    ysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlcan
    qlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyyar
    fvvknhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpla
    rrpmrfaappkdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgil
    svpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq