PDB entry 6hkz

View 6hkz on RCSB PDB site
Description: X-ray structure of human glutamate carboxypeptidase II (GCPII) in complex with a inhibitor RNA 2-49-1
Class: hydrolase
Keywords: glutamate carboxypeptidase II (GCPII); NAALADase; prostate-specific membrane antigen; urea based inhibitor, HYDROLASE
Deposited on 2018-09-09, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA, GIG27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkza1, d6hkza2, d6hkza3
  • Heterogens: ZN, CA, CL, NAG, BMA, MAN, EDO, GBZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hkzA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkzA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlp
    fdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfs
    npivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdie
    skvdpskawgevkrqiyvaaftvqaaaetlseva