PDB entry 6hkg

View 6hkg on RCSB PDB site
Description: Structure of FISW84 Fab Fragment
Class: immune system
Keywords: immune system
Deposited on 2018-09-06, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FISW84 Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HKG (0-216)
  • Chain 'B':
    Compound: FISW84 Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HKG (0-213)
    Domains in SCOPe 2.07: d6hkgb1, d6hkgb2
  • Chain 'C':
    Compound: FISW84 Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HKG (0-193)
  • Chain 'D':
    Compound: FISW84 Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HKG (0-158)
    Domains in SCOPe 2.07: d6hkgd1, d6hkgd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hkgB (B:)
    evvmtqspatlsvspgegatlscrasqsvntnvawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltistlqsedfavyycqqysnwppitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hkgD (D:)
    evvmtqspatlsvspgegatlscrasqsvntnvawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltistlqsedfavyycqqysnwppitfgqgtrleikrtvaapsvfifp
    ptasvvcllnnfyprensqesvteqdskdstyslsstlt