PDB entry 6hjw

View 6hjw on RCSB PDB site
Description: Crystal structure of the chloroplast chorismate mutase from Zea mays
Class: plant protein
Keywords: chorismate mutase, zea mays, chloroplast, PLANT PROTEIN
Deposited on 2018-09-04, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Zea mays [TaxId:4577]
    Gene: 100272431, ZEAMMB73_Zm00001d043356
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4FNK8 (Start-311)
      • conflict (308)
    Domains in SCOPe 2.07: d6hjwa_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Zea mays [TaxId:4577]
    Gene: 100272431, ZEAMMB73_Zm00001d043356
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4FNK8 (Start-311)
      • conflict (308)
      • expression tag (312-314)
    Domains in SCOPe 2.07: d6hjwb1, d6hjwb2
  • Heterogens: TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hjwA (A:)
    mafklitkaaaaspaaahrgglargpegtsrvafgpaprnkglraannsatpvakeervd
    rseiltldsirqvlirledsiifglleraqfcynadtydsnafhmdgfggslveymvret
    eklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfdellp
    rlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrdqlm
    hlltyetveraiehrveakakifgqevnigvedngsppvykivpslvaelysyrimpltk
    evqiayllkrld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjwA (A:)
    ervdrseiltldsirqvlirledsiifglleraqfcynadtydsnafhmgslveymvret
    eklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfdellp
    rlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrdqlm
    hlltyetveraiehrveakakifgqevykivpslvaelysyrimpltkevqiayllkrld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hjwB (B:)
    mafklitkaaaaspaaahrgglargpegtsrvafgpaprnkglraannsatpvakeervd
    rseiltldsirqvlirledsiifglleraqfcynadtydsnafhmdgfggslveymvret
    eklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfdellp
    rlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrdqlm
    hlltyetveraiehrveakakifgqevnigvedngsppvykivpslvaelysyrimpltk
    evqiayllkrldhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjwB (B:)
    rvdrseiltldsirqvlirledsiifglleraqfcynadtydsnafhmdgfggslveymv
    reteklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfde
    llprlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrd
    qlmhlltyetveraiehrveakakifgqeykivpslvaelysyrimpltkevqiayllkr
    ldhhh