PDB entry 6hjk

View 6hjk on RCSB PDB site
Description: Crystal Structure of Aurora-A L210C catalytic domain in complex with ASDO2
Class: transferase
Keywords: Protein kinase, mitosis, TRANSFERASE
Deposited on 2018-09-04, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (91)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d6hjka_
  • Heterogens: G7W, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hjkA (A:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvyliceyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsnaqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjkA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvyliceyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvagtldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitansskps