PDB entry 6hfy

View 6hfy on RCSB PDB site
Description: Influenza A virus N6 neuraminidase complex with DANA (Duck/England/56).
Class: hydrolase
Keywords: Influenza, A, DANA, N6, neuraminidase, Duck, Virus, enzyme, Inhibitor, Complex, HYDROLASE
Deposited on 2018-08-22, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Duck/England/1/1956 H11N6) [TaxId:383550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hfya_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Duck/England/1/1956 H11N6) [TaxId:383550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hfyb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Duck/England/1/1956 H11N6) [TaxId:383550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hfyc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Duck/England/1/1956 H11N6) [TaxId:383550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hfyd_
  • Heterogens: NAG, BMA, MAN, DAN, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hfyA (A:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hfyB (B:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hfyC (C:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hfyD (D:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe